Structure of PDB 7of6 Chain 0 Binding Site BS02

Receptor Information

>7of6 Chain 0 (length=108) Species: 9606 (Homo sapiens)

AAPKNRRTIEVNRCRRRNPQKLIKVKNNIDVCPECGHLKQKHVLCAYCYE
KVCKETAEIRRQIGKQEGGPFKAPTIETVVLYTGETPSEQDQGKRIIERD
RKRPSWFT

Ligand information

• Ligand ID: ZN
• InChI: InChI=1S/Zn/q+2
• InChIKey: PTFCDOFLOPIGGS-UHFFFAOYSA-N
• SMILES:
  CACTVS 3.341: [Zn++]
  ACDLabs 10.04
  OpenEye OEToolkits 1.5.0: [Zn+2]
• Formula: Zn
• Name: ZINC ION
• ChEMBL: CHEMBL1236970
• DrugBank: DB14532
• PDB chain: 7of6 Chain 0 Residue 200

Receptor-Ligand Complex Structure

Structure summary

• PDB: 7of6 Structural basis of GTPase-mediated mitochondrial ribosome biogenesis and recycling.
• Resolution: 2.6 Å
• Binding residue (original residue number in PDB): C110 C123 C126
• Binding residue (residue number reindexed from 1): C32 C45 C48
• Annotation score: 4

Gene Ontology

Molecular Function

• GO:0003723 RNA binding
• GO:0003735 structural constituent of ribosome
• GO:0005515 protein binding

Biological Process

• GO:0006412 translation
• GO:0032543 mitochondrial translation

Cellular Component

• GO:0005739 mitochondrion
• GO:0005743 mitochondrial inner membrane
• GO:0005759 mitochondrial matrix
• GO:0005761 mitochondrial ribosome
• GO:0005762 mitochondrial large ribosomal subunit
• GO:0005840 ribosome
• GO:0015934 large ribosomal subunit
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:7of6, PDBe:7of6, PDBj:7of6
• PDBsum: 7of6
• PubMed: 34135319
• UniProt: Q9BYC8|RM32_HUMAN Large ribosomal subunit protein bL32m (Gene Name=MRPL32)