Structure of PDB 4yuu Chain z2 Binding Site BS01

Receptor Information
>4yuu Chain z2 (length=59) Species: 2771 (Cyanidium caldarium) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
MSIILQILVVALIVYSFVLIVAVPITLSTASGWSKSKSSIVTASIGWVGM
VLLTGVLNS
Ligand information
>4yuu Chain y2 (length=27) Species: 2771 (Cyanidium caldarium) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
WQVIVQLVFLALIITTGPVIIVYLSTR
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB4yuu Novel Features of Eukaryotic Photosystem II Revealed by Its Crystal Structure Analysis from a Red Alga
Resolution2.77 Å
Binding residue
(original residue number in PDB)		V21 I25 S28
Binding residue
(residue number reindexed from 1)		V21 I25 S28
Gene Ontology
--> -->
 
 
UnboundLocalError		Python 3.6.8: /usr/bin/python3
Fri Nov 15 16:18:12 2024

A problem occurred in a Python script. Here is the sequence of function calls leading up to the error, in the order they occurred.

 /var/www/html/BioLiP/pdb.cgi in <module>()
   1435     title=pdb2title(pdbid)
   1436     if bs.startswith("BS"):
=> 1437         pubmed,uniprot=display_interaction(pdbid,asym_id,bs,title)
   1438     else:
   1439         if lig3:
pubmed = '', uniprot = '', display_interaction = <function display_interaction>, pdbid = '4yuu', asym_id = 'z2', bs = 'BS01', title = 'Novel Features of Eukaryotic Photosystem II Reve...by Its Crystal Structure Analysis from a Red Alga'
 /var/www/html/BioLiP/pdb.cgi in display_interaction(pdbid='4yuu', asym_id='z2', bs='BS01', title='Novel Features of Eukaryotic Photosystem II Reve...by Its Crystal Structure Analysis from a Red Alga')
   1295         display_ec(ec,csaOrig,csaRenu)
   1296     if go:
=> 1297         display_go(go,uniprot,pdbid,asym_id)
   1298     return pubmed,uniprot
   1299 
global display_go = <function display_go>, go = '0009523,0009539,0015979,0042549', uniprot = '', pdbid = '4yuu', asym_id = 'z2'
 /var/www/html/BioLiP/pdb.cgi in display_go(go='0009523,0009539,0015979,0042549', uniprot='', pdbid='4yuu', asym_id='z2')
    480         '''.replace("$namespace_link",namespace_link
    481           ).replace("$namespace",namespace
=>  482           ).replace("$uniprot",u
    483         ))
    484         for l,(term,name) in enumerate(go2aspect[Aspect]):
u undefined

UnboundLocalError: local variable 'u' referenced before assignment
      args = ("local variable 'u' referenced before assignment",)
      with_traceback = <built-in method with_traceback of UnboundLocalError object>