Structure of PDB 8r55 Chain z Binding Site BS01

Receptor Information
>8r55 Chain z (length=139) Species: 1423 (Bacillus subtilis) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
KRDFKPGDEVKVLTFGQKGTLLEKTGGNEWNVQIGILKMKVKEKDLEFIK
SAPKGKDYHVSLELDLRGERYENALSRVEKYLDDAVLAGYPRVSIIHGKG
TGALRKGVQDLLKNHRSVKSSRFGEAGEGGSGVTVVELK
Ligand information
>8r55 Chain V (length=33) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
agaccaaugccauguacgucgcacucggaagac
.................................
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8r55 B. subtilis MutS2 splits stalled ribosomes into subunits without mRNA cleavage.
Resolution3.57 Å
Binding residue
(original residue number in PDB)		R713 G714 E715 R716 Y717 I742 H743 G744 K745 G746 T747 G748 A749 L750 S777 G778
Binding residue
(residue number reindexed from 1)		R67 G68 E69 R70 Y71 I96 H97 G98 K99 G100 T101 G102 A103 L104 S131 G132
Gene Ontology
--> -->
 
 
UnboundLocalError		Python 3.6.8: /usr/bin/python3
Sat Nov 16 19:24:52 2024

A problem occurred in a Python script. Here is the sequence of function calls leading up to the error, in the order they occurred.

 /var/www/html/BioLiP/pdb.cgi in <module>()
   1435     title=pdb2title(pdbid)
   1436     if bs.startswith("BS"):
=> 1437         pubmed,uniprot=display_interaction(pdbid,asym_id,bs,title)
   1438     else:
   1439         if lig3:
pubmed = '', uniprot = '', display_interaction = <function display_interaction>, pdbid = '8r55', asym_id = 'z', bs = 'BS01', title = 'B. subtilis MutS2 splits stalled ribosomes into subunits without mRNA cleavage.'
 /var/www/html/BioLiP/pdb.cgi in display_interaction(pdbid='8r55', asym_id='z', bs='BS01', title='B. subtilis MutS2 splits stalled ribosomes into subunits without mRNA cleavage.')
   1295         display_ec(ec,csaOrig,csaRenu)
   1296     if go:
=> 1297         display_go(go,uniprot,pdbid,asym_id)
   1298     return pubmed,uniprot
   1299 
global display_go = <function display_go>, go = '0004519,0005524,0006298,0016887,0030983,0045910', uniprot = '', pdbid = '8r55', asym_id = 'z'
 /var/www/html/BioLiP/pdb.cgi in display_go(go='0004519,0005524,0006298,0016887,0030983,0045910', uniprot='', pdbid='8r55', asym_id='z')
    480         '''.replace("$namespace_link",namespace_link
    481           ).replace("$namespace",namespace
=>  482           ).replace("$uniprot",u
    483         ))
    484         for l,(term,name) in enumerate(go2aspect[Aspect]):
u undefined

UnboundLocalError: local variable 'u' referenced before assignment
      args = ("local variable 'u' referenced before assignment",)
      with_traceback = <built-in method with_traceback of UnboundLocalError object>