Structure of PDB 7w5b Chain z Binding Site BS01

Receptor Information
>7w5b Chain z (length=60) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
RGLDKRTPAQAAFEKMQEKRQMERILKKASKTHKQRVEDFNRHLDTLTEH
YDIPKVSWTK
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7w5b Mechanism of exon ligation by human spliceosome.
Resolution4.3 Å
Binding residue
(original residue number in PDB)		K107 S109
Binding residue
(residue number reindexed from 1)		K55 S57
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003723 RNA binding
GO:0005515 protein binding
Biological Process
GO:0006915 apoptotic process
GO:0008150 biological_process
Cellular Component
GO:0005634 nucleus
GO:0005654 nucleoplasm
GO:0005730 nucleolus

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:7w5b, PDBe:7w5b, PDBj:7w5b
PDBsum7w5b
PubMed35705093
UniProtQ9Y421|FA32A_HUMAN Protein FAM32A (Gene Name=FAM32A)

[Back to BioLiP]