Structure of PDB 6ahd Chain z Binding Site BS01

Receptor Information
>6ahd Chain z (length=61) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
ALENYINRTVAVITSDGRMIVGTLKGFDQTINLILDESHEEQVVLGLYIV
RGDNVAVIGEI
Ligand information
>6ahd Chain F (length=94) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
gugcucgcuucggcagcacauauacuaaaauuggaacgauacagagaaga
uuagcauggccccugcgcaaggaugacauucgugaagcguauuu
<<<<<.<<....>>>>>>>...............................
............................................
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6ahd Structures of the human pre-catalytic spliceosome and its precursor spliceosome.
Resolution3.8 Å
Binding residue
(original residue number in PDB)		Q32 T33
Binding residue
(residue number reindexed from 1)		Q29 T30
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003723 RNA binding
GO:0003729 mRNA binding
GO:0005515 protein binding
GO:0017070 U6 snRNA binding
Biological Process
GO:0000398 mRNA splicing, via spliceosome
GO:0006397 mRNA processing
GO:0008380 RNA splicing
Cellular Component
GO:0005634 nucleus
GO:0005654 nucleoplasm
GO:0005681 spliceosomal complex
GO:0005688 U6 snRNP
GO:0046540 U4/U6 x U5 tri-snRNP complex
GO:0071005 U2-type precatalytic spliceosome
GO:0071011 precatalytic spliceosome
GO:0120115 Lsm2-8 complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:6ahd, PDBe:6ahd, PDBj:6ahd
PDBsum6ahd
PubMed30315277
UniProtO95777|LSM8_HUMAN U6 snRNA-associated Sm-like protein LSm8 (Gene Name=LSM8)

[Back to BioLiP]