Structure of PDB 3wu2 Chain z Binding Site BS01

Receptor Information
>3wu2 Chain z (length=60) Species: 32053 (Thermostichus vulcanus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
TILFQLALAALVILSFVMVIGVPVAYASPQDWDRSKQLIFLGSGLWIALV
LVVGVLNFFV
Ligand information
>3wu2 Chain y (length=28) Species: 32053 (Thermostichus vulcanus) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
IAQLTMIAMIGIAGPMIIFLLAVRRGNL
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB3wu2 Crystal structure of oxygen-evolving photosystem II at a resolution of 1.9 A
Resolution1.9 Å
Binding residue
(original residue number in PDB)		F17 P24 V25 A28 S29 P30
Binding residue
(residue number reindexed from 1)		F16 P23 V24 A27 S28 P29
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Biological Process
GO:0015979 photosynthesis
GO:0042549 photosystem II stabilization
Cellular Component
GO:0009523 photosystem II
GO:0009539 photosystem II reaction center
GO:0009579 thylakoid
GO:0016020 membrane
GO:0031676 plasma membrane-derived thylakoid membrane
GO:0042651 thylakoid membrane

View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:3wu2, PDBe:3wu2, PDBj:3wu2
PDBsum3wu2
PubMed21499260
UniProtD0VWR5|PSBZ_THEVL Photosystem II reaction center protein Z (Gene Name=psbZ)

[Back to BioLiP]