Structure of PDB 8bq6 Chain y Binding Site BS01

Receptor Information
>8bq6 Chain y (length=265) Species: 3702 (Arabidopsis thaliana) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
MGTLGRAIYTVGNWIRGTGQALDRVGSLLQGSHRIEEHLSRHRTLMNVFD
KSPLVDKDVFVAPSASVIGDVQIGKGSSIWYGCVLRGDVNNISVGSGTNI
QDNTLVHVAKTNISGKVLPTLIGDNVTVGHSAVIHGCTVEDDAFVGMGAT
LLDGVVVEKHAMVAAGSLVKQNTRIPSGEVWGGNPAKFMRKLTDEEIVYI
SQSAKNYINLAQIHASENSKSFEQIEVERALRKKYARKDEDYDSMLGITR
ETPPELILPDNVLPG
Ligand information
>8bq6 Chain v (length=29) Species: 3702 (Arabidopsis thaliana) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
KVSEDKNRNYAVVAGVVAIVGSIGWYLKA
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8bq6 Cryo-EM structure of the respiratory I + III 2 supercomplex from Arabidopsis thaliana at 2 angstrom resolution.
Resolution2.8 Å
Binding residue
(original residue number in PDB)		M1 L4 G5 I8 Y9
Binding residue
(residue number reindexed from 1)		M1 L4 G5 I8 Y9
Enzymatic activity
Enzyme Commision number 4.2.1.-
Gene Ontology
Molecular Function
GO:0004089 carbonate dehydratase activity
GO:0005515 protein binding
GO:0016829 lyase activity
GO:0042802 identical protein binding
GO:0046872 metal ion binding
Biological Process
GO:0009853 photorespiration
GO:0009901 anther dehiscence
GO:0070207 protein homotrimerization
GO:2000377 regulation of reactive oxygen species metabolic process
Cellular Component
GO:0005634 nucleus
GO:0005737 cytoplasm
GO:0005739 mitochondrion
GO:0016020 membrane
GO:0031966 mitochondrial membrane
GO:0045271 respiratory chain complex I

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:8bq6, PDBe:8bq6, PDBj:8bq6
PDBsum8bq6
PubMed36585502
UniProtQ9C6B3|GCA2_ARATH Gamma carbonic anhydrase 2, mitochondrial (Gene Name=GAMMACA2)

[Back to BioLiP]