Structure of PDB 7abh Chain y Binding Site BS01

Receptor Information

>7abh Chain y (length=100) Species: 9606 (Homo sapiens)

AKHHPDLIFCRKQAGVAIGRLCEKCDGKCVICDSYVRPCTLVRICDECNY
GSYQGRCVICGGPGVSDAYYCKECTIQEKDRDGCPKIVNLGSSKTDLFYE

Ligand information

>7abh Chain Z (length=28)

augaugucauacuuauccugucccuuuu

............................

Receptor-Ligand Complex Structure

Structure summary

• PDB: 7abh Mechanism of protein-guided folding of the active site U2/U6 RNA during spliceosome activation.
• Resolution: 4.5 Å
• Binding residue (original residue number in PDB): K3 H4
• Binding residue (residue number reindexed from 1): K2 H3

Gene Ontology

Molecular Function

• GO:0003677 DNA binding
• GO:0003723 RNA binding
• GO:0005515 protein binding
• GO:0008270 zinc ion binding
• GO:0046872 metal ion binding

Biological Process

• GO:0000398 mRNA splicing, via spliceosome
• GO:0006397 mRNA processing
• GO:0008380 RNA splicing
• GO:0045893 positive regulation of DNA-templated transcription
• GO:0048863 stem cell differentiation
• GO:1903241 U2-type prespliceosome assembly

Cellular Component

• GO:0005634 nucleus
• GO:0005654 nucleoplasm
• GO:0005681 spliceosomal complex
• GO:0005684 U2-type spliceosomal complex
• GO:0005686 U2 snRNP
• GO:0005689 U12-type spliceosomal complex
• GO:0016363 nuclear matrix
• GO:0016607 nuclear speck
• GO:0071005 U2-type precatalytic spliceosome
• GO:0071011 precatalytic spliceosome

External links

• PDB: RCSB:7abh, PDBe:7abh, PDBj:7abh
• PDBsum: 7abh
• PubMed: 33243851
• UniProt: Q7RTV0|PHF5A_HUMAN PHD finger-like domain-containing protein 5A (Gene Name=PHF5A)