Structure of PDB 6h4n Chain y Binding Site BS01

Receptor Information
>6h4n Chain y (length=351) Species: 679895 (Escherichia coli BW25113) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
ESFAQLFEESLKEIETRPGSIVRGVVVAIDKDVVLVDAGLKSESAIPAEQ
FKNAQGELEIQVGDEVDVALDAVEDGFGETLLSREKAKRHEAWITLEKAY
EDAETVTGVINGKVKGGFTVELNGIRAFLPGSLVDVRPVRDTLHLEGKEL
EFKVIKLDQKRNNVVVSRRAVIESEDPWVAIAKRYPEGTKLTGRVTNLTD
YGCFVEIEEGVEGLVHVSEMDWTNKNIHPSKVVNVGDVVEVMVLDIDEER
RRISLGLKQCKANPWQQFAETHNKGDRVEGKIKSITDFGIFIGLDGGIDG
LVHLSDISWNVAGEEAVREYKKGDEIAAVVLQVDAERERISLGVKQLAED
P
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6h4n Structure of a hibernating 100S ribosome reveals an inactive conformation of the ribosomal protein S1.
Resolution3.0 Å
Binding residue
(original residue number in PDB)
N286 Y290 F293 E301 L303 H305 R341 I342 S343
Binding residue
(residue number reindexed from 1)
N197 Y201 F204 E212 L214 H216 R252 I253 S254
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003676 nucleic acid binding
GO:0003723 RNA binding
GO:0003727 single-stranded RNA binding
GO:0003729 mRNA binding
GO:0003735 structural constituent of ribosome
Biological Process
GO:0000028 ribosomal small subunit assembly
GO:0002181 cytoplasmic translation
GO:0006412 translation
GO:0010501 RNA secondary structure unwinding
GO:2000766 negative regulation of cytoplasmic translation
GO:2000767 positive regulation of cytoplasmic translation
Cellular Component
GO:0005737 cytoplasm
GO:0005840 ribosome
GO:0016020 membrane
GO:0022627 cytosolic small ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component
External links
PDB RCSB:6h4n, PDBe:6h4n, PDBj:6h4n
PDBsum6h4n
PubMed30177741
UniProtP0AG67|RS1_ECOLI Small ribosomal subunit protein bS1 (Gene Name=rpsA)

[Back to BioLiP]