Structure of PDB 6fti Chain y Binding Site BS01

Receptor Information
>6fti Chain y (length=62) Species: 9615 (Canis lupus familiaris) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
FVEPSRQFVKDSIRLVKRCTKPDRKEFQKIAMATAIGFAIMGFIGFFVKL
IHIPINNIIVGG
Ligand information
>6fti Chain z (length=29) Species: 9615 (Canis lupus familiaris) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
VGPVPVLVMSLLFIASVFMLHIWGKYTRS
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6fti Structural basis for coupling protein transport and N-glycosylation at the mammalian endoplasmic reticulum.
Resolution4.2 Å
Binding residue
(original residue number in PDB)		I65 G68
Binding residue
(residue number reindexed from 1)		I59 G62
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0005543 phospholipid binding
GO:0008320 protein transmembrane transporter activity
GO:0043022 ribosome binding
Biological Process
GO:0006605 protein targeting
GO:0006886 intracellular protein transport
GO:0015031 protein transport
GO:0022406 membrane docking
GO:0031204 post-translational protein targeting to membrane, translocation
GO:0045047 protein targeting to ER
Cellular Component
GO:0005783 endoplasmic reticulum
GO:0005789 endoplasmic reticulum membrane
GO:0016020 membrane
GO:0071261 Ssh1 translocon complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:6fti, PDBe:6fti, PDBj:6fti
PDBsum6fti
PubMed29519914
UniProtP60058|SC61G_CANLF Protein transport protein Sec61 subunit gamma (Gene Name=SEC61G)

[Back to BioLiP]