Structure of PDB 5mps Chain y Binding Site BS01

Receptor Information

>5mps Chain y (length=83) Species: 4932 (Saccharomyces cerevisiae)

ISYDQLAKLSYEKTLRNLATQKVQKDTKTGKITIADDDKLVNKLAVSLQS
ESKKRYEARKRQMQNASFINDKNKQFNEKLSRE

Ligand information

>5mps Chain 2 (length=49)

acgaaucucuuugccuuuuggcuuagaucaaguguaguaucuguucuuu

.................................................

Receptor-Ligand Complex Structure

Structure summary

• PDB: 5mps Structure of a spliceosome remodelled for exon ligation.
• Resolution: 3.85 Å
• Binding residue (original residue number in PDB): K174 R179 R181 Q202 F203 K206 R209
• Binding residue (residue number reindexed from 1): K54 R59 R61 Q75 F76 K79 R82

Gene Ontology

Molecular Function

• GO:0000384 first spliceosomal transesterification activity
• GO:0000386 second spliceosomal transesterification activity
• GO:0005515 protein binding

Biological Process

• GO:0000398 mRNA splicing, via spliceosome
• GO:0006397 mRNA processing
• GO:0008380 RNA splicing

Cellular Component

• GO:0000974 Prp19 complex
• GO:0005634 nucleus
• GO:0005681 spliceosomal complex
• GO:0005829 cytosol
• GO:0071004 U2-type prespliceosome
• GO:0071006 U2-type catalytic step 1 spliceosome
• GO:0071007 U2-type catalytic step 2 spliceosome
• GO:0071008 U2-type post-mRNA release spliceosomal complex

External links

• PDB: RCSB:5mps, PDBe:5mps, PDBj:5mps
• PDBsum: 5mps
• PubMed: 28076345
• UniProt: P53277|SYF2_YEAST Pre-mRNA-splicing factor SYF2 (Gene Name=SYF2)