Structure of PDB 8rg0 Chain x Binding Site BS01

Receptor Information
>8rg0 Chain x (length=63) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
CAVPEQFRDMPYQPFSKGDRLGKVADWTGATYQDKRYTNKYSQYAYFHEE
DESSFQLVDTART
Ligand information
>8rg0 Chain 7 (length=31) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
caacaacaacaacaaggauccaaaacagacc
...............................
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8rg0 Structural basis for translational control by the human 48S initiation complex from codon scanning toward subunit joining
Resolution3.4 Å
Binding residue
(original residue number in PDB)		D52 K53 R54
Binding residue
(residue number reindexed from 1)		D34 K35 R36
External links
PDB RCSB:8rg0, PDBe:8rg0, PDBj:8rg0
PDBsum8rg0
PubMed
UniProtO15371|EIF3D_HUMAN Eukaryotic translation initiation factor 3 subunit D (Gene Name=EIF3D)

[Back to BioLiP]