Structure of PDB 8k5o Chain w Binding Site BS01

Receptor Information
>8k5o Chain w (length=63) Species: 1052 (Halorhodospira halochloris) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
MWKLWKFVDFRMTAVGFHLFFALLAFAVHFACISSERFNWLEGAPAAEYY
MDEDPGIWKRTSY
Ligand information
>8k5o Chain v (length=28) Species: 1052 (Halorhodospira halochloris) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
GDAGIVVAVLVILAILGWPNISSTLRRW
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8k5o Structural insights into the unusual core photocomplex from a triply extremophilic purple bacterium, Halorhodospira halochloris.
Resolution2.42 Å
Binding residue
(original residue number in PDB)		W2 I57 W58 K59
Binding residue
(residue number reindexed from 1)		W2 I57 W58 K59
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0042314 bacteriochlorophyll binding
GO:0046872 metal ion binding
Cellular Component
GO:0005886 plasma membrane
GO:0016020 membrane
GO:0030076 light-harvesting complex

View graph for
Molecular Function
View graph for
Cellular Component
External links
PDB RCSB:8k5o, PDBe:8k5o, PDBj:8k5o
PDBsum8k5o
PubMed38411333
UniProtA0A0X8XBE4

[Back to BioLiP]