Structure of PDB 7ui9 Chain w Binding Site BS01

Receptor Information
>7ui9 Chain w (length=103) Species: 559292 (Saccharomyces cerevisiae S288C) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
PLPTRFEVELEFIQSLANIQYVTYLLTQQQIWKSPNFKNYLKYLEYWCNP
PYSQCIVYPNCLFILKLLNGFMESALEGLDELPKIIQLQGPQWMNEMVER
WAN
Ligand information
>7ui9 Chain z (length=25) Species: 559292 (Saccharomyces cerevisiae S288C) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
PSYSPTSPSYSPTSPSYSPTSPSYS
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7ui9 Structural basis of a transcription pre-initiation complex on a divergent promoter.
Resolution3.3 Å
Binding residue
(original residue number in PDB)
D104 K108
Binding residue
(residue number reindexed from 1)
D80 K84
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003712 transcription coregulator activity
GO:0003713 transcription coactivator activity
GO:0005515 protein binding
Biological Process
GO:0006281 DNA repair
GO:0006310 DNA recombination
GO:0006311 meiotic gene conversion
GO:0006355 regulation of DNA-templated transcription
GO:0006357 regulation of transcription by RNA polymerase II
GO:0006366 transcription by RNA polymerase II
GO:0032968 positive regulation of transcription elongation by RNA polymerase II
GO:0051123 RNA polymerase II preinitiation complex assembly
GO:0060261 positive regulation of transcription initiation by RNA polymerase II
Cellular Component
GO:0005634 nucleus
GO:0016592 mediator complex
GO:0070847 core mediator complex

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component
External links
PDB RCSB:7ui9, PDBe:7ui9, PDBj:7ui9
PDBsum7ui9
PubMed36731470
UniProtP38633|MED31_YEAST Mediator of RNA polymerase II transcription subunit 31 (Gene Name=SOH1)

[Back to BioLiP]