Structure of PDB 7tnq Chain w Binding Site BS01

Receptor Information
>7tnq Chain w (length=143) Species: 508771 (Toxoplasma gondii ME49) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
VVKRTQQGNYVPVRPDHFAGVSVALFFAKAGHSKCAQIVPVVRQFYKTTN
FSGEKAVIEIIYVSLDKDEQDFERVRALMPWCSVEYKSCLRKKLIERYRV
PNSTAIPLLIVIGPNGEEAGRMNFQQSDEFVLQRWDYRFNKWP
Ligand information
>7tnq Chain 18 (length=22) Species: 508771 (Toxoplasma gondii ME49) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
PTLPFNAQSCYRSEYVAKPLPP
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7tnq Cryo-ET of Toxoplasma parasites gives subnanometer insight into tubulin-based structures.
Resolution8.4 Å
Binding residue
(original residue number in PDB)		E139 A141
Binding residue
(residue number reindexed from 1)		E117 A119
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0004791 thioredoxin-disulfide reductase (NADPH) activity
Biological Process
GO:0030178 negative regulation of Wnt signaling pathway
GO:0031397 negative regulation of protein ubiquitination
GO:0098869 cellular oxidant detoxification
Cellular Component
GO:0005634 nucleus

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:7tnq, PDBe:7tnq, PDBj:7tnq
PDBsum7tnq
PubMed35121661
UniProtA0A125YFI4

[Back to BioLiP]