Structure of PDB 7nfx Chain w Binding Site BS01

Receptor Information
>7nfx Chain w (length=75) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
PQYQTWEEFSRAAEKLYLADPMKARVVLKYRHSDGNLCVKVTDDLVCLVY
KTDQAQDVKKIEKFHSQLMRLMVAK
Ligand information
>7nfx Chain 1 (length=249) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
gccgggcgcgguggcgcgcgccuguagucccagcuacucgggaggcugag
gcaggaggaucgcuucgcuaugccgaucggguguccgcacuaaguucggc
aucaauauggugaccucccgggagcgggggaccaccagguugccuaagga
ggggugaaccggcccaggucggaaacggagcaggucaaaacucccgugcu
gaucaguagugggaucgcgccugugaauagccuagcgagaccccgucuc
<<<<<<<<<<..(((.>>>>>>>....<<<<.)))....>>>>>>>.<<<
<<.<<.<..<<<<<..<<<<.......<.<..<<<<.<<<<<.<.<<<<<
<<<<<<.<<<<<..<<<<<<....>>>>>>..>>>>>.>>>>........
<<<<<.....<<<.<...<<<....>>>....>>>>...>>>>>.>>>>>
>>.>..>>>>>>>...>>...>>....>>>>..>>>>>..>>>.>>>>>
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7nfx Receptor compaction and GTPase rearrangement drive SRP-mediated cotranslational protein translocation into the ER.
Resolution3.2 Å
Binding residue
(original residue number in PDB)		R26 V28 K30 R32 D45
Binding residue
(residue number reindexed from 1)		R25 V27 K29 R31 D44
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003723 RNA binding
GO:0005047 signal recognition particle binding
GO:0005515 protein binding
GO:0008312 7S RNA binding
Biological Process
GO:0006614 SRP-dependent cotranslational protein targeting to membrane
GO:0045900 negative regulation of translational elongation
Cellular Component
GO:0005737 cytoplasm
GO:0005785 signal recognition particle receptor complex
GO:0005786 signal recognition particle, endoplasmic reticulum targeting
GO:0005829 cytosol
GO:0048500 signal recognition particle

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:7nfx, PDBe:7nfx, PDBj:7nfx
PDBsum7nfx
PubMed34020957
UniProtP49458|SRP09_HUMAN Signal recognition particle 9 kDa protein (Gene Name=SRP9)

[Back to BioLiP]