Structure of PDB 8fwg Chain v1 Binding Site BS01

Receptor Information
>8fwg Chain v1 (length=136) Species: 2557550 (Agrobacterium phage Milano) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
MNFNVGVDFPSFIAWDGEESFPVKVDGFNQFGFTFKTIAALTAATTFNIF
YHEPSDADPCVPGPAIRVPEVPFCDTVLLSEDGLAAVTLPETVTPDSFCA
GTVPCMNGQWISIAPATGSETNAANVQITVTMKGAT
Ligand information
>8fwg Chain e1 (length=28) Species: 2557550 (Agrobacterium phage Milano) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
MVKLNCRPLCQAPTASRLVSPPCFICRG
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8fwg Neck and capsid architecture of the robust Agrobacterium phage Milano.
Resolution3.45 Å
Binding residue
(original residue number in PDB)		E70 F73 V87 D96 S97 F98 C99 A100 T102
Binding residue
(residue number reindexed from 1)		E70 F73 V87 D96 S97 F98 C99 A100 T102
Enzymatic activity
Enzyme Commision number ?
External links