Structure of PDB 8i0w Chain v Binding Site BS01

Receptor Information
>8i0w Chain v (length=144) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
SDFYLRYYVGHKGKFGHEFLEFEFRPDGKLRYANNSNYKNDVMIRKEAYV
HKSVMEELKRIIDDSEITKEDDALWPPPDRVGRQELEIVIGDEHISFTTS
KIGSLIDVNQSKDPEGLRVFYYLVQDLKCLVFSLIGLHFKIKPI
Ligand information
>8i0w Chain x (length=25) Species: 9606 (Homo sapiens) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
LDDDEDRKNPAYIPRKGLFFEHDLR
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8i0w Molecular basis for the activation of human spliceosome
Resolution3.4 Å
Binding residue
(original residue number in PDB)		H15 K18 F19 Y42 K43 R84 V85
Binding residue
(residue number reindexed from 1)		H11 K14 F15 Y38 K39 R80 V81
Gene Ontology
Molecular Function
GO:0003723 RNA binding
GO:0005515 protein binding
Biological Process
GO:0000184 nuclear-transcribed mRNA catabolic process, nonsense-mediated decay
GO:0000381 regulation of alternative mRNA splicing, via spliceosome
GO:0000398 mRNA splicing, via spliceosome
GO:0006397 mRNA processing
GO:0006406 mRNA export from nucleus
GO:0006417 regulation of translation
GO:0008380 RNA splicing
GO:0050684 regulation of mRNA processing
GO:0051028 mRNA transport
GO:2000622 regulation of nuclear-transcribed mRNA catabolic process, nonsense-mediated decay
Cellular Component
GO:0005634 nucleus
GO:0005654 nucleoplasm
GO:0005681 spliceosomal complex
GO:0005737 cytoplasm
GO:0005829 cytosol
GO:0016607 nuclear speck
GO:0035145 exon-exon junction complex
GO:0071013 catalytic step 2 spliceosome
GO:1990501 exon-exon junction subcomplex mago-y14

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:8i0w, PDBe:8i0w, PDBj:8i0w
PDBsum8i0w
PubMed39068178
UniProtP61326|MGN_HUMAN Protein mago nashi homolog (Gene Name=MAGOH)

[Back to BioLiP]