Structure of PDB 6ypu Chain v Binding Site BS01

Receptor Information
>6ypu Chain v (length=60) Species: 575584 (Acinetobacter baumannii ATCC 19606 = CIP 70.34 = JCM 6841) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
PQVKLKEGEPVDVAIRRFKRSCEKAGVLADVRKREFYEKPTQERKRKKAA
AVKRYQKKLA
Ligand information
>6ypu Chain 4 (length=146) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
ccuuguacacaccgcccgucacaccaugggaguuuguugcaccagaagua
gcuagccuaacugcaaagagggcgguuaccacgguguggccgaugacugg
ggugaagucguaacaagguagccguaggggaaccugcggcuggauc
.............<..<<.<.<<<<.<<<..<<<.<<<<<<<<....<<<
<<<.<<<<..<<....>>.>>>>>>>>>>...>>>>>>>>.>>>..>>>.
>>>>..>.>>...>.....<<<<<<<<<....>>>>>>>>>.....
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6ypu Structure of the 70S Ribosome from the Human Pathogen Acinetobacter baumannii in Complex with Clinically Relevant Antibiotics.
Resolution2.9 Å
Binding residue
(original residue number in PDB)		K40 T42 R45 K46
Binding residue
(residue number reindexed from 1)		K39 T41 R44 K45
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
Biological Process
GO:0006412 translation
Cellular Component
GO:0005840 ribosome
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:6ypu, PDBe:6ypu, PDBj:6ypu
PDBsum6ypu
PubMed32857965
UniProtD0C5Q3

[Back to BioLiP]