Structure of PDB 8ir3 Chain u Binding Site BS01

Receptor Information

>8ir3 Chain u (length=75) Species: 9606 (Homo sapiens)

MKRPKLKKASKRMTCHKRYKIQKKVREHHRKLRKEAKKRGHKKPRKDPGV
PNSAPFKEALLREAELRKQRLEELK

Ligand information

>8ir3 Chain r (length=24) Species: 9606 (Homo sapiens)

SWQRKMKERQERKLAKDFARHLEE

Receptor-Ligand Complex Structure

Structure summary

• PDB: 8ir3 Visualizing the nucleoplasmic maturation of human pre-60S ribosomal particles.
• Resolution: 3.5 Å
• Binding residue (original residue number in PDB): K57 L60 E63
• Binding residue (residue number reindexed from 1): K57 L60 E63

Gene Ontology

Molecular Function

• GO:0003723 RNA binding
• GO:0005515 protein binding
• GO:0005525 GTP binding
• GO:0048027 mRNA 5'-UTR binding

Biological Process

• GO:0017145 stem cell division
• GO:0019827 stem cell population maintenance
• GO:0032206 positive regulation of telomere maintenance
• GO:0033235 positive regulation of protein sumoylation
• GO:0042127 regulation of cell population proliferation
• GO:1902895 positive regulation of miRNA transcription
• GO:1904816 positive regulation of protein localization to chromosome, telomeric region

Cellular Component

• GO:0005615 extracellular space
• GO:0005634 nucleus
• GO:0005654 nucleoplasm
• GO:0005694 chromosome
• GO:0005730 nucleolus
• GO:0016020 membrane
• GO:0016604 nuclear body
• GO:0030496 midbody

External links

• PDB: RCSB:8ir3, PDBe:8ir3, PDBj:8ir3
• PDBsum: 8ir3
• PubMed: 37491604
• UniProt: Q9BVP2|GNL3_HUMAN Guanine nucleotide-binding protein-like 3 (Gene Name=GNL3)