Structure of PDB 8ine Chain u Binding Site BS01

Receptor Information
>8ine Chain u (length=239) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
QLDKEQVRKAVDALLTHCKSRKNNYGLLLNENESLFLMVVLWKIPSKELR
VRLTLPHSIRSDSEDICLFTKDEPNSTPEKTEQFYRKLLNKHGIKTVSQI
ISLQTLKKEYKSYEAKLRLLSSFDFFLTDARIRRLLPSLIGRHFYQRKKV
PVSVNLLSKNLSREINDCIGGTVLNISKSGSCSAIRIGHVGMQIEHIIEN
IVAVTKGLSEKLPEKWESVKLLFVKTEKSAALPIFSSFV
Ligand information
>8ine Chain x (length=57) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
uuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuucuuuuuuuuuuuuuuu
uuuuuuu
..................................................
.......
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8ine Visualizing the nucleoplasmic maturation of human pre-60S ribosomal particles.
Resolution3.2 Å
Binding residue
(original residue number in PDB)		F65 K76 E77 K140 Y142 R163 L164 S167 R171 S206 K207 C211 K240 F252 K254 E256 A259 A260
Binding residue
(residue number reindexed from 1)		F36 K47 E48 K111 Y113 R134 L135 S138 R142 S177 K178 C182 K211 F223 K225 E227 A230 A231
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003723 RNA binding
GO:0003730 mRNA 3'-UTR binding
GO:0005515 protein binding
GO:0045296 cadherin binding
GO:0048027 mRNA 5'-UTR binding
Biological Process
GO:0000462 maturation of SSU-rRNA from tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA)
GO:0001649 osteoblast differentiation
GO:0032880 regulation of protein localization
GO:0042981 regulation of apoptotic process
GO:2000772 regulation of cellular senescence
Cellular Component
GO:0005634 nucleus
GO:0005694 chromosome
GO:0005730 nucleolus
GO:0016020 membrane

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:8ine, PDBe:8ine, PDBj:8ine
PDBsum8ine
PubMed37491604
UniProtO76021|RL1D1_HUMAN Ribosomal L1 domain-containing protein 1 (Gene Name=RSL1D1)

[Back to BioLiP]