Structure of PDB 7pkt Chain u Binding Site BS01

Receptor Information

>7pkt Chain u (length=133) Species: 3055 (Chlamydomonas reinhardtii) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

AAAAAAMKLTAGELAFPGMIILRQRGTKFHPGANVGIGRDHTIFATGVGK
VRVDTQPGPRGERRVVSVEPLPEALAAADSALRLRQVEAELVKRRAEVKR
AMLQGRTPLEPALYFPLPRTADGQLSWLERSVA

Ligand information

>7pkt Chain 3 (length=184) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

acgucuauuggacccgaaaccgaucgaucuagcgacgugcaggucugacu
uuaaucaggaccgaacccgugucuguugcaagagacugggaugacacgug
gcuaggggugaaaggccaaucaaguucgguaauagcugguuuucugcgaa
aucuauucagguaaagaguguguacuaagaccau

............<<.<...<<<<.<.....<<<.<<<<<..<<<<<<<..
....>>>>.>>>...<<<..<<<<........>>>>.>>>....>>>>>.
>>>...<<<.....>>>......>.>>>>......>.>>...........
.<.<<<....>>>.>...................

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	7pkt How to build a ribosome from RNA fragments in Chlamydomonas mitochondria.
Resolution	3.0 Å
Binding residue (original residue number in PDB)	Q110 R112
Binding residue (residue number reindexed from 1)	Q104 R106

Enzymatic activity

Enzyme Commision number

Gene Ontology

	Molecular Function
GO:0003735	structural constituent of ribosome

	Biological Process
GO:0006412	translation

	Cellular Component
GO:0005840	ribosome
GO:1990904	ribonucleoprotein complex

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:7pkt, PDBe:7pkt, PDBj:7pkt
PDBsum	7pkt
PubMed	34887394
UniProt	A0A2K3E880

[Back to BioLiP]