Structure of PDB 6fec Chain u Binding Site BS01

Receptor Information
>6fec Chain u (length=76) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
YTAFLGNLPYDVTEESIKEFFRGLNISAVRLPREPSNPERLKGFGYAEFE
DLDSLLSALSLNEESLGNRRIRVDVA
Ligand information
>6fec Chain F (length=26) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
cagacaccauggugcaccugacuccu
..........................
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6fec Structure of a human cap-dependent 48S translation pre-initiation complex.
Resolution6.3 Å
Binding residue
(original residue number in PDB)		P32 R40 K42
Binding residue
(residue number reindexed from 1)		P32 R40 K42
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003676 nucleic acid binding
GO:0003723 RNA binding
GO:0003743 translation initiation factor activity
GO:0005515 protein binding
Biological Process
GO:0006412 translation
GO:0006413 translational initiation
GO:0006446 regulation of translational initiation
Cellular Component
GO:0005829 cytosol
GO:0016281 eukaryotic translation initiation factor 4F complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:6fec, PDBe:6fec, PDBj:6fec
PDBsum6fec
PubMed29401259
UniProtP23588|IF4B_HUMAN Eukaryotic translation initiation factor 4B (Gene Name=EIF4B)

[Back to BioLiP]