Structure of PDB 5xjc Chain u Binding Site BS01

Receptor Information
>5xjc Chain u (length=390) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
DMTKVEFETSEEVDVTPTFDTMGLREDLLRGIYAYGFEKPSAIQQRAIKQ
IIKGRDVIAQSQSGTGKTATFSISVLQCLDIQVRETQALILAPTRELAVQ
IQKGLLALGDYMNVQCHACIGGTNVGEDIRKLDYGQHVVAGTPGRVFDMI
RRRSLRTRAIKMLVLDEADEMLNKGFKEQIYDVYRYLPPATQVVLISATL
PHEILEMTNKFMTDPIRILVKRDELTLEGIKQFFVAVEREEWKFDTLCDL
YDTLTITQAVIFCNTKRKVDWLTEKMREANFTVSSMHGDMPQKERESIMK
EFRSGASRVLISTDVWARGLDVPQVSLIINYDLPNNRELYIHRIGRSGRY
GRKGVAINFVKNDDIRILRDIEQYYSTQIDEMPMNVADLI
Ligand information
>5xjc Chain G (length=84) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
ggaaacggccuccgaacgguaagagccuagcauguagaacugguuaccuc
caggguuuccuugaugaugucauacuuauccugu
..................................................
..................................
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB5xjc An Atomic Structure of the Human Spliceosome
Resolution3.6 Å
Binding residue
(original residue number in PDB)		P114 T115 R116 G142 G143 T163 G165 R166 D169 R172 E191 F197 Q200 N285 T286 K287 H308 G309 R316 T334 D335 V336 N356
Binding residue
(residue number reindexed from 1)		P93 T94 R95 G121 G122 T142 G144 R145 D148 R151 E170 F176 Q179 N264 T265 K266 H287 G288 R295 T313 D314 V315 N335
Enzymatic activity
Enzyme Commision number 3.6.4.13: RNA helicase.
Gene Ontology
Molecular Function
GO:0003676 nucleic acid binding
GO:0003723 RNA binding
GO:0003724 RNA helicase activity
GO:0003729 mRNA binding
GO:0004386 helicase activity
GO:0005515 protein binding
GO:0005524 ATP binding
GO:0008143 poly(A) binding
GO:0016787 hydrolase activity
GO:0016887 ATP hydrolysis activity
GO:0035368 selenocysteine insertion sequence binding
GO:0035613 RNA stem-loop binding
GO:0043021 ribonucleoprotein complex binding
Biological Process
GO:0000184 nuclear-transcribed mRNA catabolic process, nonsense-mediated decay
GO:0000398 mRNA splicing, via spliceosome
GO:0006364 rRNA processing
GO:0006397 mRNA processing
GO:0006406 mRNA export from nucleus
GO:0006417 regulation of translation
GO:0008306 associative learning
GO:0008380 RNA splicing
GO:0010629 negative regulation of gene expression
GO:0014070 response to organic cyclic compound
GO:0017148 negative regulation of translation
GO:0035640 exploration behavior
GO:0045727 positive regulation of translation
GO:0048701 embryonic cranial skeleton morphogenesis
GO:0051028 mRNA transport
GO:0072715 cellular response to selenite ion
GO:0090394 negative regulation of excitatory postsynaptic potential
GO:0099578 regulation of translation at postsynapse, modulating synaptic transmission
GO:1904570 negative regulation of selenocysteine incorporation
GO:1990416 cellular response to brain-derived neurotrophic factor stimulus
GO:2000622 regulation of nuclear-transcribed mRNA catabolic process, nonsense-mediated decay
Cellular Component
GO:0005634 nucleus
GO:0005654 nucleoplasm
GO:0005681 spliceosomal complex
GO:0005730 nucleolus
GO:0005737 cytoplasm
GO:0005829 cytosol
GO:0016020 membrane
GO:0016607 nuclear speck
GO:0030425 dendrite
GO:0035145 exon-exon junction complex
GO:0043025 neuronal cell body
GO:0071006 U2-type catalytic step 1 spliceosome
GO:0071013 catalytic step 2 spliceosome
GO:0098794 postsynapse
GO:0098978 glutamatergic synapse
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:5xjc, PDBe:5xjc, PDBj:5xjc
PDBsum5xjc
PubMed28502770
UniProtP38919|IF4A3_HUMAN Eukaryotic initiation factor 4A-III (Gene Name=EIF4A3)

[Back to BioLiP]