Structure of PDB 8ipx Chain t Binding Site BS01

Receptor Information
>8ipx Chain t (length=111) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
EQLTPGVVYVRHLPNLLDETQIFSYFSQFGTVTRFRLSRSKRTGNSKGYA
FVEFESEDVAKIVAETMNNYLFGERLLECHFMPPEKVHKELFKDWNIPFK
QPSYPSVKRYN
Ligand information
>8ipx Chain x (length=57) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
uuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuucuuuuuuuuuuuuuuu
uuuuuuu
..................................................
.......
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8ipx Visualizing the nucleoplasmic maturation of human pre-60S ribosomal particles.
Resolution4.3 Å
Binding residue
(original residue number in PDB)
H51 N54 R81 T82 S85 E113 R114 H127 R148
Binding residue
(residue number reindexed from 1)
H12 N15 R42 T43 S46 E74 R75 H88 R109
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003676 nucleic acid binding
GO:0003723 RNA binding
GO:0005515 protein binding
Biological Process
GO:0000463 maturation of LSU-rRNA from tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA)
GO:0009303 rRNA transcription
GO:0016072 rRNA metabolic process
GO:0065003 protein-containing complex assembly
Cellular Component
GO:0000794 condensed nuclear chromosome
GO:0005634 nucleus
GO:0005654 nucleoplasm
GO:0005694 chromosome
GO:0005730 nucleolus
GO:0005737 cytoplasm

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component
External links
PDB RCSB:8ipx, PDBe:8ipx, PDBj:8ipx
PDBsum8ipx
PubMed37491604
UniProtQ9BYG3|MK67I_HUMAN MKI67 FHA domain-interacting nucleolar phosphoprotein (Gene Name=NIFK)

[Back to BioLiP]