Structure of PDB 8ine Chain t Binding Site BS01

Receptor Information

>8ine Chain t (length=111) Species: 9606 (Homo sapiens)

EQLTPGVVYVRHLPNLLDETQIFSYFSQFGTVTRFRLSRSKRTGNSKGYA
FVEFESEDVAKIVAETMNNYLFGERLLECHFMPPEKVHKELFKDWNIPFK
QPSYPSVKRYN

Ligand information

>8ine Chain x (length=57)

uuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuucuuuuuuuuuuuuuuu
uuuuuuu

..................................................
.......

Receptor-Ligand Complex Structure

Structure summary

• PDB: 8ine Visualizing the nucleoplasmic maturation of human pre-60S ribosomal particles.
• Resolution: 3.2 Å
• Binding residue (original residue number in PDB): Y48 H51 N54 S85 K86 F90 R114 K125 H127 E129 R148 N150
• Binding residue (residue number reindexed from 1): Y9 H12 N15 S46 K47 F51 R75 K86 H88 E90 R109 N111

Gene Ontology

Molecular Function

• GO:0003676 nucleic acid binding
• GO:0003723 RNA binding
• GO:0005515 protein binding

Biological Process

• GO:0000463 maturation of LSU-rRNA from tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA)
• GO:0009303 rRNA transcription
• GO:0016072 rRNA metabolic process
• GO:0065003 protein-containing complex assembly

Cellular Component

• GO:0000794 condensed nuclear chromosome
• GO:0005634 nucleus
• GO:0005654 nucleoplasm
• GO:0005694 chromosome
• GO:0005730 nucleolus
• GO:0005737 cytoplasm

External links

• PDB: RCSB:8ine, PDBe:8ine, PDBj:8ine
• PDBsum: 8ine
• PubMed: 37491604
• UniProt: Q9BYG3|MK67I_HUMAN MKI67 FHA domain-interacting nucleolar phosphoprotein (Gene Name=NIFK)