Structure of PDB 7r6q Chain t Binding Site BS01

Receptor Information
>7r6q Chain t (length=290) Species: 1247190 (Saccharomyces cerevisiae BY4741) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
LNSNPEILLRKRRNADRTRIERQELAKKKREEQIKKKRSNKNKFVRAESI
VAKTLATSREKERIKRVSILEDKKAKNETQHIASGKDFILKITEGLIREK
TTYDGKPALLFIVRVRGPLAVNIPNKAFKILSLLRLVETNTGVFVKLTKN
VYPLLKVIAPYVVIGKPSLSSIRSLIQKRGRIIYKGENEAEPHEIVLNDN
NIVEEQLGDHGIICVEDIIHEIATMGESFSVCNFFLQPFKLNREVSGFGS
LNRLRKIKQREAESRTRQFSNAATAPVIEVDIDSLLAKLN
Ligand information
>7r6q Chain 6 (length=87) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
ccuucucaaacauucuguuugguagugagugauacucuuuggaguuaacu
ugaaauugcuggccuuuaggcgaacaauguucuuaaa
......<<<<<<...>>>>>>.....<<<<...<<<<....>>>>..>>>
>..........<<<<..>>>>................
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7r6q Sequence-specific remodeling of a topologically complex RNP substrate by Spb4.
Resolution2.98 Å
Binding residue
(original residue number in PDB)		K47 K48 N51 E59 L66 T68 R70 K72 K76 R77 S79 I80 H92 I93 A94 S95 K97 F99 R146 R148 G149 L151 V153 N154 I155 P156 N157 K158 E170 T171 R275 S278 F280 R292 S302 N303 A304
Binding residue
(residue number reindexed from 1)		K36 K37 N40 E48 L55 T57 R59 K61 K65 R66 S68 I69 H81 I82 A83 S84 K86 F88 R114 R116 G117 L119 V121 N122 I123 P124 N125 K126 E138 T139 R243 S246 F248 R260 S270 N271 A272
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003723 RNA binding
GO:0003729 mRNA binding
GO:0003735 structural constituent of ribosome
GO:0005515 protein binding
GO:0042134 rRNA primary transcript binding
Biological Process
GO:0000463 maturation of LSU-rRNA from tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA)
GO:0000465 exonucleolytic trimming to generate mature 5'-end of 5.8S rRNA from tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA)
GO:0042254 ribosome biogenesis
GO:0042273 ribosomal large subunit biogenesis
Cellular Component
GO:0005634 nucleus
GO:0005730 nucleolus
GO:0022625 cytosolic large ribosomal subunit
GO:0030687 preribosome, large subunit precursor

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:7r6q, PDBe:7r6q, PDBj:7r6q
PDBsum7r6q
PubMed36482249
UniProtP40693|RLP7_YEAST Ribosome biogenesis protein RLP7 (Gene Name=RLP7)

[Back to BioLiP]