Structure of PDB 6ff4 Chain t Binding Site BS01

Receptor Information
>6ff4 Chain t (length=172) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
GVVYKSTRSAKPVGPEDMGATAVYELDTEKERDAQAIFERSQKIQEELRG
KEDDKIYRGINNYQRKGPIRAPEHLRATVRWDYQPDICKDYKETGFCGFG
DSCKFLHDRSDYKHGWQIERELDECFICRQSFQNPVVTKCRHYFCESCAL
QHFRTTPRCYVCDQQTNGVFNP
Ligand information
>6ff4 Chain Z (length=48) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
cgccgccaagguauguaucaagcuuacaaguuauguauuuacugaccu
................................................
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6ff4 Structure and Conformational Dynamics of the Human Spliceosomal BactComplex.
Resolution3.4 Å
Binding residue
(original residue number in PDB)		I201 C202 K203 F213 C217 K218 F219
Binding residue
(residue number reindexed from 1)		I87 C88 K89 F99 C103 K104 F105
Enzymatic activity
Enzyme Commision number 2.3.2.27: RING-type E3 ubiquitin transferase.
Gene Ontology
Molecular Function
GO:0005515 protein binding
GO:0016740 transferase activity
GO:0046872 metal ion binding
GO:0061630 ubiquitin protein ligase activity
Biological Process
GO:0000398 mRNA splicing, via spliceosome
GO:0006281 DNA repair
GO:0006397 mRNA processing
GO:0008380 RNA splicing
GO:0016567 protein ubiquitination
GO:0034247 snoRNA splicing
GO:0070100 negative regulation of chemokine-mediated signaling pathway
Cellular Component
GO:0005634 nucleus
GO:0005654 nucleoplasm
GO:0005681 spliceosomal complex
GO:0005684 U2-type spliceosomal complex
GO:0016607 nuclear speck
GO:0071005 U2-type precatalytic spliceosome

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:6ff4, PDBe:6ff4, PDBj:6ff4
PDBsum6ff4
PubMed29361316
UniProtO15541|R113A_HUMAN E3 ubiquitin-protein ligase RNF113A (Gene Name=RNF113A)

[Back to BioLiP]