Structure of PDB 8fwg Chain s7 Binding Site BS01

Receptor Information
>8fwg Chain s7 (length=137) Species: 2557550 (Agrobacterium phage Milano) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
MNFNVGVDFPSFIAWDGEESFPVKVDGFNQFGFTFKTIAALTAATTFNIF
YHEPSDADPCVPGPAIRVPEVPFCDTVLLSEDGLAAVTLPETVTPDSFCA
GTVPCMNGQWISIAPATGSETNAANVQITVTMKGATR
Ligand information
>8fwg Chain b7 (length=28) Species: 2557550 (Agrobacterium phage Milano) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
MVKLNCRPLCQAPTASRLVSPPCFICRG
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8fwg Neck and capsid architecture of the robust Agrobacterium phage Milano.
Resolution3.45 Å
Binding residue
(original residue number in PDB)
F73 V87 D96 S97 F98 C99 A100
Binding residue
(residue number reindexed from 1)
F73 V87 D96 S97 F98 C99 A100
Enzymatic activity
Enzyme Commision number ?
External links