Structure of PDB 8wax Chain s Binding Site BS01

Receptor Information

>8wax Chain s (length=209) Species: 9823 (Sus scrofa) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

DDEEETYRLWKIRKTIMQLCHDRGYLVTQDELDQTLEEFKAQFGDKPSEG
RPRRTDLTVLVAHNDDPTDQMFVFFPEEPKVGIKTIKVYCQRMQEENITR
ALIVVQQGMTPSAKQSLVDMAPKYILEQFLQQELLINITEHELVPEHVVM
TKEEVTELLARYKLRENQLPRIQAGDPVARYFGIKRGQVVKIIRPSETAG
RYITYRLVQ

Ligand information

>8wax Chain X (length=43) [Search DNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

gttcttcttcatcattcgagccgagcagacgtgcctacggacc

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	8wax Structural Visualization of de novo Transcription Initiation.
Resolution	2.75 Å
Binding residue (original residue number in PDB)	I84 K85 T111
Binding residue (residue number reindexed from 1)	I83 K84 T110

Enzymatic activity

Enzyme Commision number

Gene Ontology

	Molecular Function
GO:0001054	RNA polymerase I activity
GO:0001055	RNA polymerase II activity
GO:0001056	RNA polymerase III activity
GO:0003677	DNA binding
GO:0003899	DNA-directed 5'-3' RNA polymerase activity

	Biological Process
GO:0006351	DNA-templated transcription
GO:0006362	transcription elongation by RNA polymerase I
GO:0006366	transcription by RNA polymerase II
GO:0042797	tRNA transcription by RNA polymerase III

	Cellular Component
GO:0005634	nucleus
GO:0005654	nucleoplasm
GO:0005665	RNA polymerase II, core complex
GO:0005666	RNA polymerase III complex
GO:0005736	RNA polymerase I complex

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:8wax, PDBe:8wax, PDBj:8wax
PDBsum	8wax
PubMed	38127763
UniProt	I3LSI7

[Back to BioLiP]