Structure of PDB 8gxq Chain s Binding Site BS01

Receptor Information

>8gxq Chain s (length=93) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

GPFYLMRELPGSTELTGSTNLITHYNLEQAYNKFCGKKVKEKLSNFLPDL
PGMIDLPGSHDNSSLRSLIEKPPILSSSFNPITGTMLAGFRLH

Ligand information

>8gxq Chain NX (length=162) [Search DNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

cccccccccccccccccccccccccccccccccccccccccccccccccc
cccccccccccccccccccccccccccccccccccccccccccccccccc
cccccccccccccccccccccccccccccccccccccccccccccccccc
cccccccccccc

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	8gxq Structures of +1 nucleosome-bound PIC-Mediator complex.
Resolution	5.04 Å
Binding residue (original residue number in PDB)	K104 N107
Binding residue (residue number reindexed from 1)	K42 N45

Enzymatic activity

Enzyme Commision number

Gene Ontology

	Molecular Function
GO:0003712	transcription coregulator activity
GO:0005515	protein binding

	Biological Process
GO:0006357	regulation of transcription by RNA polymerase II
GO:0032968	positive regulation of transcription elongation by RNA polymerase II
GO:0045944	positive regulation of transcription by RNA polymerase II
GO:0051123	RNA polymerase II preinitiation complex assembly
GO:0060261	positive regulation of transcription initiation by RNA polymerase II

	Cellular Component
GO:0005634	nucleus
GO:0005654	nucleoplasm
GO:0016592	mediator complex
GO:0070847	core mediator complex

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:8gxq, PDBe:8gxq, PDBj:8gxq
PDBsum	8gxq
PubMed	36201575
UniProt	A0JLT2\|MED19_HUMAN Mediator of RNA polymerase II transcription subunit 19 (Gene Name=MED19)

[Back to BioLiP]