Structure of PDB 5mmj Chain s Binding Site BS01

Receptor Information
>5mmj Chain s (length=78) Species: 3562 (Spinacia oleracea) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
KKNPFVANHLLRKIEKLNKKAEKEIIVTWSRASTIIPTMIGHTIAIHNGR
EHLPIYITDRMVGHKLGEFAPTLNFRGH
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB5mmj The complete structure of the chloroplast 70S ribosome in complex with translation factor pY.
Resolution3.6 Å
Binding residue
(original residue number in PDB)		P9 P42 D64 V67
Binding residue
(residue number reindexed from 1)		P4 P37 D59 V62
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003723 RNA binding
GO:0003735 structural constituent of ribosome
GO:0019843 rRNA binding
Biological Process
GO:0000028 ribosomal small subunit assembly
GO:0006412 translation
Cellular Component
GO:0005737 cytoplasm
GO:0005840 ribosome
GO:0009507 chloroplast
GO:0015935 small ribosomal subunit
GO:0022627 cytosolic small ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:5mmj, PDBe:5mmj, PDBj:5mmj
PDBsum5mmj
PubMed28007896
UniProtP06508|RR19_SPIOL Small ribosomal subunit protein uS19c (Gene Name=rps19)

[Back to BioLiP]