Structure of PDB 8q7n Chain r Binding Site BS01

Receptor Information
>8q7n Chain r (length=89) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
KRELLRHRDYKVDLESKLGKTIVITKTTPQSEMGGYYCNVCDCVVKDSIN
FLDHINGKKHQRNLGMSMRVERSTLDQVKKRFEVNKKKM
Ligand information
>8q7n Chain 6 (length=78) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
gugcucgcuucggcagcacauauacuaaaauuggaacgauacagagaaga
uuagcauggccccugcgcaaggaugaca
<<<<<.<<....>>>>>>>...............................
............................
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8q7n New insights into the functions of B complex proteins revealed by cryo-EM of dimerized spliceosomes
Resolution3.1 Å
Binding residue
(original residue number in PDB)
R46 K90 D91 N94 K102 R106
Binding residue
(residue number reindexed from 1)
R2 K46 D47 N50 K58 R62
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003676 nucleic acid binding
GO:0003677 DNA binding
GO:0005515 protein binding
GO:0008270 zinc ion binding
GO:0046872 metal ion binding
Biological Process
GO:0000398 mRNA splicing, via spliceosome
GO:0006397 mRNA processing
GO:0008380 RNA splicing
Cellular Component
GO:0005634 nucleus
GO:0005654 nucleoplasm
GO:0005681 spliceosomal complex
GO:0046540 U4/U6 x U5 tri-snRNP complex
GO:0071005 U2-type precatalytic spliceosome

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component
External links
PDB RCSB:8q7n, PDBe:8q7n, PDBj:8q7n
PDBsum8q7n
PubMed38383864
UniProtQ96NC0|ZMAT2_HUMAN Zinc finger matrin-type protein 2 (Gene Name=ZMAT2)

[Back to BioLiP]