Structure of PDB 8ink Chain r Binding Site BS01

Receptor Information
>8ink Chain r (length=82) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
IPKGKPKSGRVWKDRSKKRFSQMLQDKPLRTSWQRKMKERQERKLAKDFA
RHLEEEKERRRQEKKQRRAENLKRRLENERKA
Ligand information
>8ink Chain 3 (length=115) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
gucuacggccauaccacccugaacgcgcccgaucucgucugaucucggaa
gcuaagcagggucgggccugguuaguacuuggaugggaccgccuggaaua
ccgggugcuguaggc
<<<<<<<<<....<<<<<<<<.....<<<<<..............>>>..
>>....>>>>>>.>><<<<<<......<<.<<.<<<..>>>>>.>>....
>>>>>>>>>>>>>>>
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8ink Visualizing the nucleoplasmic maturation of human pre-60S ribosomal particles.
Resolution3.2 Å
Binding residue
(original residue number in PDB)		R302 E313
Binding residue
(residue number reindexed from 1)		R68 E79
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003723 RNA binding
GO:0005515 protein binding
Cellular Component
GO:0005634 nucleus
GO:0005654 nucleoplasm
GO:0005694 chromosome
GO:0005730 nucleolus

View graph for
Molecular Function
View graph for
Cellular Component
External links
PDB RCSB:8ink, PDBe:8ink, PDBj:8ink
PDBsum8ink
PubMed37491604
UniProtQ9H6F5|CCD86_HUMAN Coiled-coil domain-containing protein 86 (Gene Name=CCDC86)

[Back to BioLiP]