Structure of PDB 6ah0 Chain r Binding Site BS01

Receptor Information

>6ah0 Chain r (length=75) Species: 9606 (Homo sapiens)

EPLDLIRLSLDERIYVKMRNDRELRGRLHAYDQHLNMILGDVEETVTTIE
IYKSTKRNIPMLFVRGDGVVLVAPP

Ligand information

>6ah0 Chain F (length=69)

gugcucgcuucggcagcacagaagauuagcauggccccugcgcaaggaug
auucgugaagcguauuuuu

<<<<<.<<....>>>>>>>...............................
...................

Receptor-Ligand Complex Structure

Structure summary

• PDB: 6ah0 Structures of the human pre-catalytic spliceosome and its precursor spliceosome.
• Resolution: 5.7 Å
• Binding residue (original residue number in PDB): G89 D90
• Binding residue (residue number reindexed from 1): G66 D67

Gene Ontology

Molecular Function

• GO:0003723 RNA binding
• GO:0005515 protein binding
• GO:0030629 U6 snRNA 3'-end binding

Biological Process

• GO:0000398 mRNA splicing, via spliceosome
• GO:0006397 mRNA processing
• GO:0008380 RNA splicing
• GO:0033962 P-body assembly

Cellular Component

• GO:0000932 P-body
• GO:0005634 nucleus
• GO:0005654 nucleoplasm
• GO:0005681 spliceosomal complex
• GO:0005688 U6 snRNP
• GO:0005829 cytosol
• GO:0032991 protein-containing complex
• GO:0046540 U4/U6 x U5 tri-snRNP complex
• GO:0071005 U2-type precatalytic spliceosome
• GO:0071011 precatalytic spliceosome
• GO:0071013 catalytic step 2 spliceosome
• GO:0120115 Lsm2-8 complex
• GO:1990726 Lsm1-7-Pat1 complex

External links

• PDB: RCSB:6ah0, PDBe:6ah0, PDBj:6ah0
• PDBsum: 6ah0
• PubMed: 30315277
• UniProt: P62310|LSM3_HUMAN U6 snRNA-associated Sm-like protein LSm3 (Gene Name=LSM3)