Structure of PDB 7vd5 Chain q Binding Site BS01

Receptor Information
>7vd5 Chain q (length=151) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
SPRFSVFGLVGDGTSYSEGAAYGTDQADKLYSPYSVYSPEGEKSLYKPDN
AEYLARKKAVLAETKNRLQKIPAYVDKKEWFNVKDELTRYMYETRGAVRS
LSSSVTQKEKAEVFFRALEDTYGAATLKKGDAVKASNDKAIAALDAFTAT
L
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7vd5 Structural basis for different types of hetero-tetrameric light-harvesting complexes in a diatom PSII-FCPII supercomplex
Resolution2.5 Å
Binding residue
(original residue number in PDB)		R58 F59 S60 S70 Y71 S72
Binding residue
(residue number reindexed from 1)		R3 F4 S5 S15 Y16 S17
Enzymatic activity
Enzyme Commision number ?
External links