Structure of PDB 7qwq Chain q Binding Site BS01

Receptor Information
>7qwq Chain q (length=105) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
DRFICIYPAYLNNKKTIAEGRRIPISKAVENPTATEIQDVCSAVGLNVFL
EKNKMYSREWNRDVQYRGRVRVQLKQEDGSLCLVQFPSRKSVMLYAAEMI
PKLKT
Ligand information
>7qwq Chain 1 (length=167) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
cgcuaugccgaucggguguccgcacuaaguucggcaucaauauggugacc
ucccgggagcgggggaccaccagguugccuaaggaggggugaaccggccc
aggucggaaacggagcaggucaaaacucccgugcugaucaguagugggau
cgcgccugugaauagcc
.<<<<.........<..<<<<.<<<<<.<.<<<<<<<<<<<..<<<<..<
<<<<<....>>>>>>..>>>>..>>>>........<<<<<......<..<
.<.<<<....>>>..>.>.>....>>>>>.>>>>>>>.>..>>>>>>>..
.>>...>.....>>>>.
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7qwq Mechanism of signal sequence handover from NAC to SRP on ribosomes during ER-protein targeting.
Resolution2.83 Å
Binding residue
(original residue number in PDB)		F15 I16 C17 Y19 Y22 T28 I29 R33 R34 P36 I37 M67 Y68 S69 R70 W72 R74 R81 R101 K102
Binding residue
(residue number reindexed from 1)		F3 I4 C5 Y7 Y10 T16 I17 R21 R22 P24 I25 M55 Y56 S57 R58 W60 R62 R69 R89 K90
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003723 RNA binding
GO:0005515 protein binding
GO:0008312 7S RNA binding
GO:0043022 ribosome binding
Biological Process
GO:0006613 cotranslational protein targeting to membrane
GO:0006614 SRP-dependent cotranslational protein targeting to membrane
GO:0006617 SRP-dependent cotranslational protein targeting to membrane, signal sequence recognition
Cellular Component
GO:0005634 nucleus
GO:0005654 nucleoplasm
GO:0005730 nucleolus
GO:0005737 cytoplasm
GO:0005786 signal recognition particle, endoplasmic reticulum targeting
GO:0005829 cytosol
GO:0016604 nuclear body
GO:0048500 signal recognition particle

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:7qwq, PDBe:7qwq, PDBj:7qwq
PDBsum7qwq
PubMed35201867
UniProtP09132|SRP19_HUMAN Signal recognition particle 19 kDa protein (Gene Name=SRP19)

[Back to BioLiP]