Structure of PDB 7qi6 Chain q Binding Site BS01

Receptor Information
>7qi6 Chain q (length=166) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
YRARPPPRRRPGPRWPDPEDLLTPRWQLGPRYAAKQFARYGAASGVVPGS
LWPSPEQLRELEAEEREWYPSLATMQESLRVKQLAEEQKRREREQHIAEC
MAKMPQMIVNWQQQQRENWEKAQADKERRARLQAEAQELLGYQVDPRSAR
FQELLQDLEKKERKRL
Ligand information
>7qi6 Chain Ax (length=71) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
uagggaauaguuuaacaaaacuccugacucauccucaggagauggagguu
caauuccuccuucccuaacca
<<<<<<<...<<<....>>><<<<<<<.......>>>>>>>..<<<<<..
.....>>>>>>>>>>>>....
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7qi6 Structure of mitoribosome reveals mechanism of mRNA binding, tRNA interactions with L1 stalk, roles of cofactors and rRNA modifications.
Resolution2.98 Å
Binding residue
(original residue number in PDB)		Q180 K184 R187 K188
Binding residue
(residue number reindexed from 1)		Q156 K160 R163 K164
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0005515 protein binding
Biological Process
GO:0032543 mitochondrial translation
Cellular Component
GO:0005634 nucleus
GO:0005654 nucleoplasm
GO:0005739 mitochondrion
GO:0005743 mitochondrial inner membrane
GO:0005759 mitochondrial matrix
GO:0005762 mitochondrial large ribosomal subunit
GO:0005840 ribosome
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:7qi6, PDBe:7qi6, PDBj:7qi6
PDBsum7qi6
PubMed38769321
UniProtQ8TAE8|G45IP_HUMAN Large ribosomal subunit protein mL64 (Gene Name=GADD45GIP1)

[Back to BioLiP]