Structure of PDB 7pkt Chain q Binding Site BS01

Receptor Information

>7pkt Chain q (length=161) Species: 3055 (Chlamydomonas reinhardtii) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

PRNWMWYDADDEREERRKERQRLAWAMGPGGGEEVGAAHLMDVPQSMKKM
QRIVKLVRGLPYPDAVAQCSLVPHKAARYMLQALEAAHADATEVKGLDAE
RLVVGTVFVTRGAYEPGISYHSKGRPGSKTFHRSHIRVVLNQAAERPAPF
ARIVAPLMSRR

Ligand information

>7pkt Chain 1 (length=162) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

gggauugcugacugauagugcaaacaguacugugaaggaacuaaugaaac
ugggcuauaagugcgcauuccaccaauacgugagcauucgcgcauuacca
uucuccagaggauuuaaaugcacaaaccuauaugccuuuuggcauaugau
uacacuucguua

<<<.<<<.<<...................<<....>>....<<<.....<
<<<......<<<<<<<<...<<<......>>>.....>.>>>>>>>....
....>>>>.....>>>....>>>>>.>>>.<<<<<<....>>>>>>....
............

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	7pkt How to build a ribosome from RNA fragments in Chlamydomonas mitochondria.
Resolution	3.0 Å
Binding residue (original residue number in PDB)	R206 Q214 A217 W218 M220 M240 R251 F301 V302 T303 R304 H328 R330
Binding residue (residue number reindexed from 1)	R13 Q21 A24 W25 M27 M47 R58 F108 V109 T110 R111 H135 R137

Enzymatic activity

Enzyme Commision number

Gene Ontology

	Molecular Function
GO:0003735	structural constituent of ribosome

	Biological Process
GO:0006412	translation

	Cellular Component
GO:0005739	mitochondrion
GO:0005762	mitochondrial large ribosomal subunit
GO:0005840	ribosome
GO:0015934	large ribosomal subunit
GO:1990904	ribonucleoprotein complex

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:7pkt, PDBe:7pkt, PDBj:7pkt
PDBsum	7pkt
PubMed	34887394
UniProt	A0A2K3DSG6

[Back to BioLiP]