Structure of PDB 7obq Chain q Binding Site BS01

Receptor Information
>7obq Chain q (length=104) Species: 9615 (Canis lupus familiaris) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
RFICIYPAYLNNKKTIAEGRRIPISKAVENPTATEIQDVCSAVGLNVFLE
KNKMYSREWNRDVQYRGRVRVQLKQEDGSLCLVQFPSRKSVMLYAAEMIP
KLKT
Ligand information
>7obq Chain 1 (length=165) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
cuaugccgaucggguguccgcacuaaguucggcaucaauauggugaccuc
ccgggagcgggggaccaccagguugccuaaggaggggugaaccggcccag
gucggaaacggagcaggucaaaacucccgugcugaucaguagugggaucg
cgccugugaauagca
.<.........<<<<<<<<.<<<<<.<.<<<<<<<<<<<.<<<<<..<<<
<<<....>>>>>>..>>>>>.>>>>........<<<<<.....<<<<..<
.<<<....>>>..>.>>>>...>>>>>.>>>>>>>.>..>>>>>>>...>
>>>>>.......>..
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7obq Molecular mechanism of cargo recognition and handover by the mammalian signal recognition particle.
Resolution3.9 Å
Binding residue
(original residue number in PDB)
R14 F15 I16 C17 Y19 Y22 T28 I29 R33 P36 I37 K66 M67 S69 R70 R81 R101
Binding residue
(residue number reindexed from 1)
R1 F2 I3 C4 Y6 Y9 T15 I16 R20 P23 I24 K53 M54 S56 R57 R68 R88
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003723 RNA binding
GO:0008312 7S RNA binding
Biological Process
GO:0006614 SRP-dependent cotranslational protein targeting to membrane
GO:0006617 SRP-dependent cotranslational protein targeting to membrane, signal sequence recognition
Cellular Component
GO:0005634 nucleus
GO:0005654 nucleoplasm
GO:0005730 nucleolus
GO:0005737 cytoplasm
GO:0005786 signal recognition particle, endoplasmic reticulum targeting
GO:0048500 signal recognition particle

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component
External links
PDB RCSB:7obq, PDBe:7obq, PDBj:7obq
PDBsum7obq
PubMed34260909
UniProtJ9PAS6|SRP19_CANLF Signal recognition particle 19 kDa protein (Gene Name=SRP19)

[Back to BioLiP]