Structure of PDB 9fmd Chain p Binding Site BS01

Receptor Information
>9fmd Chain p (length=92) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
IRPNHTIYINNMNDKIKKEELKRSLYALFSQFGHVVDIVALKTMKMRGQA
FVIFKELGSSTNALRQLQGFPFYGKPMRIQYAKTDSDIISKM
Ligand information
>9fmd Chain 2 (length=120) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
aucgcuucucggccuuuuggcuaagaucaaguguaguaucuguucuuauc
aguuuaauauauauuaaaagauuuuuggaacugcaucgaccugguauugc
aguaccuccaggaacggugc
..................................................
...<<<<<<..>>>>>>...............<<<<<<.<<<<<......
.......>>>>>..>>>>>>
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB9fmd Mechanism for the initiation of spliceosome disassembly.
Resolution3.3 Å
Binding residue
(original residue number in PDB)		Y10 N13 D16 K17 K20 K24 V41 L43 K44 T45 K47 M48 R49 Q51 F53 A84 K85 T86 D87 S88 D89
Binding residue
(residue number reindexed from 1)		Y8 N11 D14 K15 K18 K22 V39 L41 K42 T43 K45 M46 R47 Q49 F51 A82 K83 T84 D85 S86 D87
Gene Ontology
Molecular Function
GO:0003723 RNA binding
GO:0005515 protein binding
GO:0030619 U1 snRNA binding
Biological Process
GO:0000398 mRNA splicing, via spliceosome
GO:0006397 mRNA processing
GO:0008380 RNA splicing
GO:1903241 U2-type prespliceosome assembly
Cellular Component
GO:0001650 fibrillar center
GO:0005634 nucleus
GO:0005654 nucleoplasm
GO:0005681 spliceosomal complex
GO:0005684 U2-type spliceosomal complex
GO:0005685 U1 snRNP
GO:0005686 U2 snRNP
GO:0016607 nuclear speck
GO:0036464 cytoplasmic ribonucleoprotein granule
GO:0071005 U2-type precatalytic spliceosome
GO:0071007 U2-type catalytic step 2 spliceosome
GO:0071013 catalytic step 2 spliceosome

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:9fmd, PDBe:9fmd, PDBj:9fmd
PDBsum9fmd
PubMed38925148
UniProtP08579|RU2B_HUMAN U2 small nuclear ribonucleoprotein B'' (Gene Name=SNRPB2)

[Back to BioLiP]