Structure of PDB 8i0v Chain p Binding Site BS01

Receptor Information
>8i0v Chain p (length=90) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
PNHTIYINNMNDKIKKEELKRSLYALFSQFGHVVDIVALKTMKMRGQAFV
IFKELGSSTNALRQLQGFPFYGKPMRIQYAKTDSDIISKM
Ligand information
>8i0v Chain H (length=151) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
aucgcuucucggccuuuuggcuaagaucaaguguaguaucuguuuaucag
uuuaauaucugauggauuuuuggagcagggagauggaauaggagcuugcu
ccguccacuccacgcaucgaccugguauugcaguaccuccaggaacggug
c
..............................................<<<<
........>>>>................<<<<.<<<<...<<<<....>>
>>.>>>>>>>>..<<<<<<.<<<<<.............>>>>>..>>>>>
>
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8i0v Molecular basis for the activation of human spliceosome
Resolution3.0 Å
Binding residue
(original residue number in PDB)
D16 K44 K47 R49
Binding residue
(residue number reindexed from 1)
D12 K40 K43 R45
Gene Ontology
Molecular Function
GO:0003723 RNA binding
GO:0005515 protein binding
GO:0030619 U1 snRNA binding
Biological Process
GO:0000398 mRNA splicing, via spliceosome
GO:0006397 mRNA processing
GO:0008380 RNA splicing
GO:1903241 U2-type prespliceosome assembly
Cellular Component
GO:0001650 fibrillar center
GO:0005634 nucleus
GO:0005654 nucleoplasm
GO:0005681 spliceosomal complex
GO:0005684 U2-type spliceosomal complex
GO:0005685 U1 snRNP
GO:0005686 U2 snRNP
GO:0016607 nuclear speck
GO:0036464 cytoplasmic ribonucleoprotein granule
GO:0071005 U2-type precatalytic spliceosome
GO:0071007 U2-type catalytic step 2 spliceosome
GO:0071013 catalytic step 2 spliceosome

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component
External links
PDB RCSB:8i0v, PDBe:8i0v, PDBj:8i0v
PDBsum8i0v
PubMed39068178
UniProtP08579|RU2B_HUMAN U2 small nuclear ribonucleoprotein B'' (Gene Name=SNRPB2)

[Back to BioLiP]