Structure of PDB 7znk Chain p Binding Site BS01

Receptor Information
>7znk Chain p (length=367) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
LKPELLRAIVDCGFEHPSEVQHECIPQAILGMDVLCQAMGKTAVFVLATL
QQLEPVTGQVSVLVMCHTRELAFQISKEYERFSKYMPNVKVAVFFGGLSI
KKDEEVLKKNCPHIVVGTPGRILALARNKSLNLKHIKHFILDECDKMLEQ
LDMRRDVQEIFRMTPHEKQVMMFSATLSKEIRPVCRKFMQDPMEIFVKLT
LHGLQQYYVKLKDNEKNRKLFDLLDVLEFNQVVIFVKSVQRCIALAQLLV
EQNFPAIAIHRGMPQEERLSRYQQFKDFQRRILVATNLFGRGMDIERVNI
AFNYDMPEDSDTYLHRVARAGRFGTKGLAITFVSDENDAKILNDVQDRFE
VNISELPDEIDISSYIE
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7znk mRNA recognition and packaging by the human transcription-export complex.
Resolution3.9 Å
Binding residue
(original residue number in PDB)		T122 R123 G150 G151 T172 P173 G174 R175 D206
Binding residue
(residue number reindexed from 1)		T68 R69 G96 G97 T118 P119 G120 R121 D152
Enzymatic activity
Enzyme Commision number 3.6.4.13: RNA helicase.
Gene Ontology
Molecular Function
GO:0003676 nucleic acid binding
GO:0003723 RNA binding
GO:0003724 RNA helicase activity
GO:0003729 mRNA binding
GO:0004386 helicase activity
GO:0005515 protein binding
GO:0005524 ATP binding
GO:0008186 ATP-dependent activity, acting on RNA
GO:0016787 hydrolase activity
GO:0016887 ATP hydrolysis activity
GO:0017070 U6 snRNA binding
GO:0030621 U4 snRNA binding
GO:0042802 identical protein binding
GO:0043008 ATP-dependent protein binding
Biological Process
GO:0000245 spliceosomal complex assembly
GO:0000398 mRNA splicing, via spliceosome
GO:0006397 mRNA processing
GO:0006405 RNA export from nucleus
GO:0006406 mRNA export from nucleus
GO:0008380 RNA splicing
GO:0010501 RNA secondary structure unwinding
GO:0051028 mRNA transport
Cellular Component
GO:0000346 transcription export complex
GO:0005634 nucleus
GO:0005654 nucleoplasm
GO:0005681 spliceosomal complex
GO:0005687 U4 snRNP
GO:0005688 U6 snRNP
GO:0005737 cytoplasm
GO:0016607 nuclear speck

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:7znk, PDBe:7znk, PDBj:7znk
PDBsum7znk
PubMed37020021
UniProtQ13838|DX39B_HUMAN Spliceosome RNA helicase DDX39B (Gene Name=DDX39B)

[Back to BioLiP]