Structure of PDB 7qiw Chain p Binding Site BS01

Receptor Information
>7qiw Chain p (length=99) Species: 4081 (Solanum lycopersicum) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
VNVPKTKKTYCKSKECKKHTLHKVTQYKKGKDSLAAQGKRRYDRKQSGYG
GQTKPVFHKKAKTTKKIVLRLQCQGCKHVSQHPIKRCKHFEIGGDKKGK
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7qiw Cryo-EM structure and rRNA modification sites of a plant ribosome.
Resolution2.35 Å
Binding residue
(original residue number in PDB)		Y43 K55 P56 F58
Binding residue
(residue number reindexed from 1)		Y42 K54 P55 F57
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
Biological Process
GO:0006412 translation
Cellular Component
GO:0005840 ribosome
GO:0022625 cytosolic large ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:7qiw, PDBe:7qiw, PDBj:7qiw
PDBsum7qiw
PubMed35643637
UniProtA0A3Q7H1I0

[Back to BioLiP]