Structure of PDB 7aqw Chain p Binding Site BS01

Receptor Information
>7aqw Chain p (length=93) Species: 3702 (Arabidopsis thaliana) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
GRKKGLPEFEESAPDGFDPENPYKDPVAMVEMREHIVREKWIQIEKAKIL
REKVKWCYRVEGVNHYQKCRHLVQQYLDSTRGVGWGKDHRPIS
Ligand information
>7aqw Chain i (length=15) Species: 3702 (Arabidopsis thaliana) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
GFIMEFAENLVLRLM
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7aqw A ferredoxin bridge connects the two arms of plant mitochondrial complex I.
Resolution3.17 Å
Binding residue
(original residue number in PDB)		G2 R3
Binding residue
(residue number reindexed from 1)		G1 R2
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Biological Process
GO:0009853 photorespiration
Cellular Component
GO:0005739 mitochondrion
GO:0005743 mitochondrial inner membrane
GO:0005829 cytosol
GO:0031966 mitochondrial membrane
GO:0045271 respiratory chain complex I

View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:7aqw, PDBe:7aqw, PDBj:7aqw
PDBsum7aqw
PubMed33768254
UniProtQ94C12|NDBAB_ARATH NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 10-B (Gene Name=At3g18410)

[Back to BioLiP]