Structure of PDB 7a23 Chain p Binding Site BS01

Receptor Information
>7a23 Chain p (length=224) Species: 3712 (Brassica oleracea) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
RAFYSVGFWIRETGQALDRLGCRLQGKNYFREQLSRHRTLMNVFDKAPIV
DKEAFVAPSASVIGDVHIGRGSSIWYGCVLRGDVNTVSVGSGTNIQDNSL
VHVAKSNLSGKVHPTIIGDNVTIGHSAVLHGCTVEDETFIGMGATLLDGV
VVEKHGMVAAGALVRQNTRIPSGEVWGGNPARFLRKLTDEEIAFISQSAT
NYSNLAQAHAAENAKPLNVIEFEK
Ligand information
>7a23 Chain n (length=27) Species: 3712 (Brassica oleracea) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
VSEDKNRNYAVVAGVVAIVGSIGWYLK
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7a23 Specific features and assembly of the plant mitochondrial complex I revealed by cryo-EM.
Resolution3.7 Å
Binding residue
(original residue number in PDB)		L29 Q30 G31
Binding residue
(residue number reindexed from 1)		L24 Q25 G26
Enzymatic activity
Enzyme Commision number 4.2.1.-
Gene Ontology
Molecular Function
GO:0004089 carbonate dehydratase activity
GO:0016829 lyase activity
GO:0046872 metal ion binding
Biological Process
GO:0009853 photorespiration
GO:0070207 protein homotrimerization
Cellular Component
GO:0005634 nucleus
GO:0005739 mitochondrion
GO:0016020 membrane
GO:0031966 mitochondrial membrane
GO:0045271 respiratory chain complex I

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:7a23, PDBe:7a23, PDBj:7a23
PDBsum7a23
PubMed33060577
UniProtQ9FWR5|GCA1_ARATH Gamma carbonic anhydrase 1, mitochondrial (Gene Name=GAMMACA1)

[Back to BioLiP]