Structure of PDB 6x0m Chain p Binding Site BS01

Receptor Information
>6x0m Chain p (length=468) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
APVDPECTAKVGKAHVYCEGNDVYDVMLNQTNLQFNNNKYYLIQLLEDDA
QRNFSVWMRWGRVGKMGQHSLVACSGNLNKAKEIFQKKFLDKTKNNWEDR
EKFEKVPGKYDMLQMDYQLDLRVQELIKLICNVQAMEEMMMEMKYNTKKA
PLGKLTVAQIKAGYQSLKKIEDCIRAGQHGRALMEACNEFYTRIPHDFGL
RTPPLIRTQKELSEKIQLLEALGDIEIAIKLVKTELQSPEHPLDQHYRNL
HCALRPLDHESYEFKVISQYLQSTHAPTHSDYTMTLLDLFEVEKDGEKEA
FREDLHNRMLLWHGSRMSNWVGILSHGLRIAPPEAPITGYMFGKGIYFAD
MSSKSANYCFASRLKNTGLLLLSEVALGQCNELLEANPKAEGLLQGKHST
KGLGKMAPSSAHFVTLNGSTVPLGPASDTGILNPDGYTLNYNEYIVYNPN
QVRMRYLLKVQFNFLQLW
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6x0m Bridging of DNA breaks activates PARP2-HPF1 to modify chromatin.
Resolution6.3 Å
Binding residue
(original residue number in PDB)		Y119 W138 K170 Y188
Binding residue
(residue number reindexed from 1)		Y41 W60 K92 Y110
Enzymatic activity
Catalytic site (original residue number in PDB) S457 Y460 E545
Catalytic site (residue number reindexed from 1) S355 Y358 E443
Enzyme Commision number 2.4.2.-
2.4.2.30: NAD(+) ADP-ribosyltransferase.
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0003682 chromatin binding
GO:0003684 damaged DNA binding
GO:0003950 NAD+-protein poly-ADP-ribosyltransferase activity
GO:0005515 protein binding
GO:0016757 glycosyltransferase activity
GO:0016779 nucleotidyltransferase activity
GO:0031491 nucleosome binding
GO:0072572 poly-ADP-D-ribose binding
GO:0140294 NAD DNA ADP-ribosyltransferase activity
GO:0140805 NAD+-protein-serine ADP-ribosyltransferase activity
GO:0140806 NAD+-protein-aspartate ADP-ribosyltransferase activity
GO:0140807 NAD+-protein-glutamate ADP-ribosyltransferase activity
GO:0160004 poly-ADP-D-ribose modification-dependent protein binding
GO:1990404 NAD+-protein ADP-ribosyltransferase activity
Biological Process
GO:0006281 DNA repair
GO:0006284 base-excision repair
GO:0006302 double-strand break repair
GO:0006974 DNA damage response
GO:0030592 DNA ADP-ribosylation
GO:0046697 decidualization
GO:0061051 positive regulation of cell growth involved in cardiac muscle cell development
GO:0070212 protein poly-ADP-ribosylation
GO:0070213 protein auto-ADP-ribosylation
GO:0090649 response to oxygen-glucose deprivation
GO:0097191 extrinsic apoptotic signaling pathway
GO:0110088 hippocampal neuron apoptotic process
GO:0140861 DNA repair-dependent chromatin remodeling
Cellular Component
GO:0005634 nucleus
GO:0005654 nucleoplasm
GO:0005694 chromosome
GO:0005730 nucleolus
GO:0090734 site of DNA damage

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:6x0m, PDBe:6x0m, PDBj:6x0m
PDBsum6x0m
PubMed32939087
UniProtQ9UGN5|PARP2_HUMAN Poly [ADP-ribose] polymerase 2 (Gene Name=PARP2)

[Back to BioLiP]