Structure of PDB 5zwo Chain p Binding Site BS01

Receptor Information

>5zwo Chain p (length=73) Species: 559292 (Saccharomyces cerevisiae S288C) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

TLYVSQLNEKINMQRLRVNLFLLFATFGEVVSMNFKKQRGQAFITMRTID
QASLAQISLNGERFFGKPLKVEF

Ligand information

>5zwo Chain H (length=150) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

gaaucucuuugaguguaguaucuguucuuuucaguguaacaacugaaaug
accuaggcucauacauuuuuuggcacggacgggaagaggagacgucgcga
cccucggagucguucuugacuuggucgcuugauguuucuucuucccguuc

.............................<<<<<<......>>>>>><<<
<<<..>>.>>>>...............<<<<<<<<<<.<<<<<<<<<<<<
.<<...<<<<<<....>>>>>>>>>>>>..>>>>>>>>.>>>>>>>>>>.

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	5zwo Structures of the fully assembledSaccharomyces cerevisiaespliceosome before activation
Resolution	3.9 Å
Binding residue (original residue number in PDB)	K66 K67
Binding residue (residue number reindexed from 1)	K36 K37

Enzymatic activity

Enzyme Commision number

Gene Ontology

	Molecular Function
GO:0003676	nucleic acid binding
GO:0003723	RNA binding
GO:0030620	U2 snRNA binding

	Biological Process
GO:0000398	mRNA splicing, via spliceosome
GO:0006397	mRNA processing
GO:0008380	RNA splicing
GO:1903241	U2-type prespliceosome assembly

	Cellular Component
GO:0005634	nucleus
GO:0005681	spliceosomal complex
GO:0005686	U2 snRNP
GO:0071004	U2-type prespliceosome
GO:1990904	ribonucleoprotein complex

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:5zwo, PDBe:5zwo, PDBj:5zwo
PDBsum	5zwo
PubMed	29794219
UniProt	P40567\|MSL1_YEAST U2 small nuclear ribonucleoprotein B'' (Gene Name=MSL1)

[Back to BioLiP]