Structure of PDB 8v83 Chain o Binding Site BS01

Receptor Information
>8v83 Chain o (length=133) Species: 1247190 (Saccharomyces cerevisiae BY4741) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
EYSGIIYVSRLPHGFHEKELSKYFAQFGDLKEVRLARNKKTGNSRHYGFL
EFVNKEDAMIAQESMNNYLLMGHLLQVRVLPKGAKIEKLYKYKKRVLVEK
GITKPVKQLKDNMKQKHEERIKKLAKSGIEFKW
Ligand information
>8v83 Chain 6 (length=58) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
ccuucucaaacauguuugguagugagugauacucgaguuaacuugaaauu
gccuuaaa
......<<<<<..>>>>>.....<<<<.<.<<<..>>>>.>>>>......
........
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8v83 The DEAD-box ATPase Dbp10/DDX54 initiates peptidyl transferase center formation during 60S ribosome biogenesis.
Resolution2.53 Å
Binding residue
(original residue number in PDB)		Y94 R97 H100 R124 N125 K126 N130 S131 R132 H133 Y134 F136 M158 H160 I173 K175 Y179 I189 R207
Binding residue
(residue number reindexed from 1)		Y7 R10 H13 R37 N38 K39 N43 S44 R45 H46 Y47 F49 M71 H73 I86 K88 Y92 I102 R120
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003674 molecular_function
GO:0003676 nucleic acid binding
GO:0003723 RNA binding
GO:0005515 protein binding
GO:0019843 rRNA binding
Biological Process
GO:0000463 maturation of LSU-rRNA from tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA)
GO:0006364 rRNA processing
GO:0042254 ribosome biogenesis
GO:0042273 ribosomal large subunit biogenesis
Cellular Component
GO:0005634 nucleus
GO:0005730 nucleolus
GO:0005737 cytoplasm
GO:0030687 preribosome, large subunit precursor
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:8v83, PDBe:8v83, PDBj:8v83
PDBsum8v83
PubMed38632236
UniProtP53927|NOP15_YEAST Ribosome biogenesis protein 15 (Gene Name=NOP15)

[Back to BioLiP]