Structure of PDB 8rt5 Chain o Binding Site BS01

Receptor Information
>8rt5 Chain o (length=115) Species: 562 (Escherichia coli) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
LDVPSSSRYDHRIRYVTYNPADVVQVDTVLGVATHIMLEEGEQYLTHAFG
DSEAYAFARKGRHIFIKPQAELANTNLIVVTDRRSYKFRLQMRNDRNGAM
YELAFRYPDTQARQT
Ligand information
>8rt5 Chain n (length=19) Species: 562 (Escherichia coli) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
KTPYELARERMLRSGLTAG
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8rt5 Cryo-EM structure of a conjugative type IV secretion system suggests a molecular switch regulating pilus biogenesis.
Resolution2.69 Å
Binding residue
(original residue number in PDB)		H67 A68 F69 D71 S72 E73 A90 E91 L92
Binding residue
(residue number reindexed from 1)		H47 A48 F49 D51 S52 E53 A70 E71 L72
External links